Mbl2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mbl2, Each
$ 1,420.20
|
|
Details:
This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and n-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [Provided by refseqsequence: dgdsslaaserkalqtemarikkwltfslgkqvgnkffltngeimtfekvkalcvkfqasvatprnaaengaiqnlikeeaflgitdektegqfvdltgnrltytnwnegepnnagsdedcvlllkngqwndvpcstsh
Additional Information
| SKU | 10286473 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20103 |
