Web Analytics
518-831-8000 sales@utechproducts.com

Mcoln2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mcoln2, Each

$ 1,757.70

Details

Mucolipins constitute a family of cation channel proteins with homology to the transient receptor potential superfamily. In mammals, the mucolipin family includes 3 members, mcoln1 (mim 605248), mcoln2, and mcoln3 (mim 607400), that exhibit a common 6-membrane-spanning topology. Homologs of mammalian mucolipins exist in drosophila and c. Elegans. Mutations in the human mcoln1 gene cause mucolipodosis iv (mim 262650) (karacsonyi et al., 2007 [Pubmed 17662026]).[Supplied by omimsequence: yhqlkditlgtlgygenednriglkvckqhykkgtmfpsnetlnidndveldcvqldlqdlskkppdwknssffrlefyr

Additional Information

SKU 10287303
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21061