Web Analytics
518-831-8000 sales@utechproducts.com

Mcoln3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mcoln3, Each

$ 1,757.70

Details

Mucolipins constitute a family of cation channel proteins with homologs in mouse, drosophila, and c. Elegans. Mutations in the human mcoln1 gene (mim 605248) cause mucolipodosis iv (mim 262650).[Supplied by omimsequence: yenkgtkqsamaicqhfykrgniypgndtfdidpeietecffvepdepfhigtpaenklnltldfhrlltvelqfklkainlqtvrhqelpdcydftlt

Additional Information

SKU 10287259
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21014