Web Analytics
518-831-8000 sales@utechproducts.com

MDFIC, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MDFIC, Each

1,757.70

Details:

This gene product is a member of a family of proteins characterized by a specific cysteine-rich C-terminal domain, which is involved in transcriptional regulation of viral genome expression. Alternative translation initiation from an upstream non-AUG (GUG), and an in-frame, downstream AUG codon, results in the production of two isoforms, p40 and p32, respectively, which have different subcellular localization; p32 is mainly found in the cytoplasm, whereas p40 is targeted to the nucleolus. Both isoforms have transcriptional regulatory activity that is attributable to the cysteine-rich C-terminal domain. [provided by RefSeqSequence: QDQSIWGNPSDGELIRTQPQRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLSVNSD

Additional Information

SKU 10288782
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22762