Mdfic, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mdfic, Each

Details:

This gene product is a member of a family of proteins characterized by a specific cysteine-rich c-terminal domain, which is involved in transcriptional regulation of viral genome expression. Alternative translation initiation from an upstream non-aug (gug), and an in-frame, downstream aug codon, results in the production of two isoforms, p40 and p32, respectively, which have different subcellular localization; p32 is mainly found in the cytoplasm, whereas p40 is targeted to the nucleolus. Both isoforms have transcriptional regulatory activity that is attributable to the cysteine-rich c-terminal domain. [Provided by refseqsequence: qdqsiwgnpsdgelirtqpqrlpqlqtsaqvpsgeeigkiknghtglsngngihhgakhgsadnrklsapvsqkmhrkiqsslsvnsd