Web Analytics
518-831-8000 sales@utechproducts.com

ME3 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ME3, Each

1,757.70

Details:

Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD or NADP as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP( )-dependent isoform, a mitochondrial NADP( )-dependent isoform, and a mitochondrial NAD( )-dependent isoform. This gene encodes a mitochondrial NADP( )-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeqSequence: DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV

Additional Information

SKU 10289232
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23293