Web Analytics
518-831-8000 sales@utechproducts.com

Minpp1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Minpp1, Each

$ 1,757.70

Details

This gene encodes multiple inositol polyphosphate phosphatase; an enzyme that removes 3-phosphate from inositol phosphate substrates. It is the only enzyme known to hydrolzye inositol pentakisphosphate and inositol hexakisphosphate. This enzyme also converts 2,3 bisphosphoglycerate (2,3-bpg) to 2-phosphoglycerate; an activity formerly thought to be exclusive to 2,3-bpg synthase/2-phosphatase (bpgm) in the rapoport-luebering shunt of the glycolytic pathwaysequence: lvalirhgtryptvkqirklrqlhgllqargsrdggasstgsrdlgaaladwplwyadwmdgqlvekgrqdmrqlalrlaslfpalfsrenygrlrlitsskhrcmdssaaflqglwqhyhpgl

Additional Information

SKU 10288003
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21844