Mipep Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mipep, Each
$ 1,757.70
|
|
Details:
The product of this gene performs the final step in processing a specific class of nuclear-encoded proteins targeted to the mitochondrial matrix or inner membrane. This protein is primarily involved in the maturation of oxidative phosphorylation (oxphos)-related proteins. This gene may contribute to the functional effects of frataxin deficiency and the clinical manifestations of friedreich ataxia. [Provided by refseqsequence: lrfshlvgygaryysylmsravasmvwkecflqdpfnraageryrremlahgggrepmlmvegmlqkcpsvddfvsalvsdldldfetflmds
Additional Information
| SKU | 10288538 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22478 |
