Web Analytics
518-831-8000 sales@utechproducts.com

MNS1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MNS1, Each

1,757.70

Details:

This gene encodes a protein highly similar to the mouse meiosis-specific nuclear structural 1 protein. The mouse protein was shown to be expressed at the pachytene stage during spermatogenesis and may function as a nuclear skeletal protein to regulate nuclear morphology during meiosis. [provided by RefSeqSequence: QQVRENSIELRELEKKLKAAYMNKERAAQIAEKDAIKYEQMKRDAEIAKTMMEEHKRIIKEENAAEDKRNKAKA

Additional Information

SKU 10289550
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23653