Web Analytics
518-831-8000 sales@utechproducts.com

Mocs1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mocs1, Each

1,757.70

Details

Molybdenum cofactor biosynthesis is a conserved pathway leading to the biological activation of molybdenum. The protein encoded by this gene is involved in molybdenum cofactor biosynthesis. This gene was originally thought to produce a bicistronic mrna with the potential to produce two proteins (mocs1a and mocs1b) from adjacent open reading frames. However, only the first open reading frame (mocs1a) has been found to encode a protein from the putative bicistronic mrna. Two of the splice variants found for this gene express proteins (mocs1a-mocs1b) that result from a fusion between the two open reading frames. This gene is defective in patients with molybdenum cofactor deficiency, type a. [Provided by refseqsequence: lvpakfefivrrkgfhkvmegihkaielgynpvkvncvvmrglnedelldfaalteglpldvrfieympfdgnkwnfkkmvsyk

Additional Information

SKU 10290120
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24447