Mocs1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mocs1, Each
|
|
Details:
Molybdenum cofactor biosynthesis is a conserved pathway leading to the biological activation of molybdenum. The protein encoded by this gene is involved in molybdenum cofactor biosynthesis. This gene was originally thought to produce a bicistronic mrna with the potential to produce two proteins (mocs1a and mocs1b) from adjacent open reading frames. However, only the first open reading frame (mocs1a) has been found to encode a protein from the putative bicistronic mrna. Two of the splice variants found for this gene express proteins (mocs1a-mocs1b) that result from a fusion between the two open reading frames. This gene is defective in patients with molybdenum cofactor deficiency, type a. [Provided by refseqsequence: lvpakfefivrrkgfhkvmegihkaielgynpvkvncvvmrglnedelldfaalteglpldvrfieympfdgnkwnfkkmvsyk
Additional Information
| SKU | 10290120 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24447 |
