Web Analytics
518-831-8000 sales@utechproducts.com

Mov10l1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mov10l1, Each

1,757.70

Details:

This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: EYISYVTEIHEEDVTLKINPEFEQAYNFEPMDVEFTYNRTTSRRCHFALEHVIHLGVKVLFPEEIILQSPQVTGNWNHAQDTKSSGQSTSKKNRKTMTDQ

Additional Information

SKU 10287417
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21186