Mpdu1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mpdu1, Each

Details:

This gene encodes an endoplasmic reticulum membrane protein that is required for utilization of the mannose donor mannose-p-dolichol in the synthesis of lipid-linked oligosaccharides and glycosylphosphatidylinositols. Mutations in this gene result in congenital disorder of glycosylation type if. Alternative splicing results in multiple transcript variants. [Provided by refseqsequence: aeadgplkrllvpillpekcydqlfvqwdllhvpclkillsk