Mrpl12, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mrpl12, Each

Details:

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28s subunit and a large 39s subunit. They have an estimated 75% protein to rrna composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5s rrna. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39s subunit protein which forms homodimers. In prokaryotic ribosomes, two l7/l12 dimers and one l10 protein form the l8 protein complex. [Provided by refseqsequence: sltrfaiyetvrdrvakgsqgplpfhekvllgsvsglaggfvgtpadlvnvrmqndvklpqgqrrnyahal