Web Analytics
518-831-8000 sales@utechproducts.com

Mrpl20 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mrpl20, Each

2,214.00

Details

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28s subunit and a large 39s subunit. They have an estimated 75% protein to rrna composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5s rrna. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39s subunit protein. A pseudogene corresponding to this gene is found on chromosome 21q. [Provided by refseqsequence: asqehglkypalignlvkcqvelnrkvladlaiyepktfkslaalasrrrhegfaaalgdgkepegifsrvvqyh

Additional Information

SKU 10290188
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24526