Web Analytics
518-831-8000 sales@utechproducts.com

Mrpl41 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mrpl41, Each

1,757.70

Details:

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28s subunit and a large 39s subunit. They have an estimated 75% protein to rrna composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5s rrna. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39s subunit protein that belongs to the yml27 ribosomal protein family. [Provided by refseqsequence: kpyvsylapeseetpltaaqlfseavapaiekdfkdgtfdpdnlekygfeptqegklfqlyprnflr

Additional Information

SKU 10287882
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21710