Web Analytics
518-831-8000 sales@utechproducts.com

Mrps24 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mrps24, Each

$ 1,757.70

Details

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28s subunit and a large 39s subunit. They have an estimated 75% protein to rrna composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5s rrna. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28s subunit protein. A pseudogene corresponding to this gene is found on chromosome 11. [Provided by refseqsequence: gtfpgcladqlvlkrrgnqleicavvlrqlsphkyyflvgysetllsyfykcpvrlhlqtvpskvvyky

Additional Information

SKU 10292016
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28022