Web Analytics
518-831-8000 sales@utechproducts.com

Mto1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Mto1, Each

1,757.70

Details

This gene encodes a mitochondrial protein thought to be involved in mitochondrial trna modification. The encoded protein may also play a role in the expression of the nonsyndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12s rrna gene. Multiple transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: mscnpsfggigkghlmrevdaldglcsricdqsgvhykvlnrrkgpavwglraqidrklykqnmqkeilntplltvqegavedliltepepehtgkcrvsgvvl

Additional Information

SKU 10288485
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22422