Web Analytics
518-831-8000 sales@utechproducts.com

MYO18B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant MYO18B, Each

1,750.95

Details:

The protein encoded by this gene may regulate muscle-specific genes when in the nucleus and may influence intracellular trafficking when in the cytoplasm. The encoded protein functions as a homodimer and may interact with F actin. Mutations in this gene are associated with lung cancer. [provided by RefSeqSequence: GSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTPTSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKSADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKY

Additional Information

SKU 10286400
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20025