Web Analytics
518-831-8000 sales@utechproducts.com

Myo5a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Myo5a, Each

$ 1,750.95

Details

This gene is one of three myosin v heavy-chain genes, belonging to the myosin gene superfamily. Myosin v is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mrna translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause griscelli syndrome type-1 (gs1), griscelli syndrome type-3 (gs3) and neuroectodermal melanolysosomal disease, or elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined. [Provided by refseqsequence: qnlqlppearieaslqheitrltnenldlmeqlekqdktvrklkkqlkvfakkigelevgqmenispgqiidepirpvniprkekdfqgmleykkedeqklvknlilelkprgvavnlipg

Additional Information

SKU 10286424
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20053