Web Analytics
518-831-8000 sales@utechproducts.com

NALCN Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NALCN, Each

1,757.70

Details:

NALCN forms a voltage-independent, nonselective, noninactivating cation channel permeable to Na , K , and Ca(2 ). It is responsible for the neuronal background sodium leak conductance (Lu et al., 2007 [PubMed 17448995]).[supplied by OMIMSequence: TYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNE

Additional Information

SKU 10288803
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22787