Web Analytics
518-831-8000 sales@utechproducts.com

NARG1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NARG1, Each

1,757.70

Details:

This gene encodes a protein of unknown function. However, similarity to proteins in yeast and other species suggests that this protein may be an N-acetyltransferase. [provided by RefSeqSequence: ALEHLCTYEKQICDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNFLSGEKFKECLDKFLRMNFSKG

Additional Information

SKU 10287773
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21591