Web Analytics
518-831-8000 sales@utechproducts.com

Nav1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nav1, Each

$ 1,757.70

Details

This gene belongs to the neuron navigator family and is expressed predominantly in the nervous system. The encoded protein contains coiled-coil domains and a conserved aaa domain characteristic for atpases associated with a variety of cellular activities. This gene is similar to unc-53, a caenorhabditis elegans gene involved in axon guidance. The exact function of this gene is not known. [Provided by refseqsequence: aksfvkppslanldkvnsnsldlpsssdtthaskvpdlhatssasggplpscftpspapilninsasfsqglelmsgfsvpketrmypklsglhrsmeslqmpmslpsafpsstpvptppappaapteeeteeltwsgsp

Additional Information

SKU 10288204
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22080