Web Analytics
518-831-8000 sales@utechproducts.com

NCAPH, subunit H, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NCAPH, subunit H, Each

1,757.70

Details:

This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. [provided by RefSeqSequence: LHCQDYRSELLFPSDVQTLSTGEPLELPELGCVEMTDLKAPLQQCAEDRQICPSLAGFQFTQWDSETHNESVSALVDKFKKNDQVFDINAEVDESDCGDFPDGSLGDDFDANDEPDHT

Additional Information

SKU 10292516
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28677