Ndp Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ndp, Each

Details:

This gene encodes a secreted protein with a cystein-knot motif that activates the wnt/beta-catenin pathway. The protein forms disulfide-linked oligomers in the extracellular matrix. Mutations in this gene result in norrie disease and x-linked exudative vitreoretinopathy. [Provided by refseqsequence: tdssfimdsdprrcmrhhyvdsishplykcsskmvllarceghcsqasrseplvsfstvlkqpfrsschccrpqtsklkalrlrcsggmrltatyryilschceecns