Ndufaf3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ndufaf3, Each

Details:

This gene encodes a mitochondrial complex i assembly protein that interacts with complex i subunits. Mutations in this gene cause mitochondrial complex i deficiency, a fatal neonatal disorder of the oxidative phosphorylation system. Alternatively spliced transcript variants encoding different isoforms have been identified. [Provided by refseqsequence: lleprieivvvgtgdrterlqsqvlqamrqrgiavevqdtpnacatfnflchegrvtgaalipppggtsltslgqaaq