Nkx2-2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nkx2-2, Each

Details:

The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near nkx2-4, and these two genes appear to be duplicated on chromosome 14 in the form of titf1 and nkx2-8. The encoded protein is likely to be a nuclear transcription factor. [Provided by refseqsequence: sltntktgfsvkdildlpdtndeegsvaegpeeenegpepakragplgqgaldavqslplknpfydssdnpytrwlasteglqyslhglaagappqdssskspepsadespdndketp