Web Analytics
518-831-8000 sales@utechproducts.com

NLGN4X, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NLGN4X, Each

1,757.70

Details:

This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeqSequence: QYPVVNTNYGKIRGLRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGIRNTTQFAAVCPQHLDERSLLHDMLPIWFTANLDTLMTYVQDQNEDCLYLNIYVPTEDDIHDQNSKKPVMVYIHGGSYMEGTGNMIDGS

Additional Information

SKU 10292353
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28472