Nlgn4x, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nlgn4x, Each

Details:

This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (drosophila) homolog 4 (dlg4). Mutations in this gene have been associated with autism and asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene. [Provided by refseqsequence: qypvvntnygkirglrtplpneilgpveqylgvpyaspptgerrfqppeppsswtgirnttqfaavcpqhldersllhdmlpiwftanldtlmtyvqdqnedclylniyvpteddihdqnskkpvmvyihggsymegtgnmidgs