Web Analytics
518-831-8000 sales@utechproducts.com

Nlrp10 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nlrp10, Each

$ 1,757.70

Details

Members of the nalp protein family typically contain a nacht domain, a nacht-associated domain (nad), a c-terminal leucine-rich repeat (lrr) region, and an n-terminal pyrin domain (pyd). The protein encoded by this gene belongs to the nalp protein family despite lacking the lrr region. This protein likely plays a regulatory role in the innate immune system. The protein belongs to the signal-induced multiprotein complex, the inflammasome, that activates the pro-inflammatory caspases, caspase-1 and caspase-5. Other experiments indicate that this gene acts as a multifunctional negative regulator of inflammation and apoptosis. [Provided by refseqsequence: raryfssyftdekqadrafdivqkndilykacqvpgicwvvcswlqgqmergkvvletprnstdifmayvstflppdddggcselsrhrv

Additional Information

SKU 10289522
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23622