Nlrp14 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nlrp14, Each

Details:

The protein encoded by this gene belongs to the nalp protein family. Members of the nalp protein family typically contain a nacht domain, a nacht-associated domain (nad), a c-terminal leucine-rich repeat (lrr) region, and an n-terminal pyrin domain (pyd). This protein may play a regulatory role in the innate immune system as similar family members belong to the signal-induced multiprotein complex, the inflammasome, that activates the pro-inflammatory caspases, caspase-1 and caspase-5. [Provided by refseqsequence: ekawsvslkifgkmnlkdlcerakeeinwsaqtigpddakagetqedqeavlgdgteyrnrikekfcitwdkkslagkpedfhhgiaekdrkllehlfdvdvk