Web Analytics
518-831-8000 sales@utechproducts.com

NME1-NME2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NME1-NME2, Each

1,420.20

Details:

The NME1-NME2 mRNA is a naturally occurring co-transcribed product of the neighboring NME1 and NME2 genes. The significance of this co-transcribed mRNA and the function of its predicted protein product have not yet been determined. Alternative splicing of this gene results in different transcript variants encoding distinct isoforms, but the full-length nature of each variant has not been defined. [provided by RefSeqSequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ

Additional Information

SKU 10291691
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27463