Glycerol Kinase Antibody Blocking Peptide, Highly Purified. Generating Reliable And Reproducible Results. Applications: Antibody Competition, Each

Details:

A blocking peptide from human glycerol kinase. Source: synthetic amino acid sequence: (accession #: np_976325)maagaaegvgvwslepedlsavtmerfepqinaeeseirystwkkavmks the glycerol kinase blocking peptide is derived from synthetic. The glycerol kinase blocking peptide has been validated for the following applications: antibody competition.