Mtr Antibody Blocking Peptide, Highly Purified. Generating Reliable And Reproducible Results. Applications: Antibody Competition, Each
$ 294.98
|
|
Details:
A blocking peptide from human mtr. Source: synthetic amino acid sequence: (accession #: np_000245) gseqldvadlrrlrykgirpapgypsqpdhtekltmwrladieqstgirl. The mtr blocking peptide is derived from synthetic. The mtr blocking peptide has been validated for the following applications: antibody competition.
Additional Information
| SKU | 10177848 |
|---|---|
| UOM | Each |
| UNSPSC | 41105906 |
| Manufacturer Part Number | NBP179285PEP |
