Wnt-3a Antibody Blocking Peptide, Highly Purified. Generating Reliable And Reproducible Results. Applications: Antibody Competition, Each
$ 294.98
|
|
Details
A blocking peptide from mouse wnt3a. Source: synthetic amino acid sequence: (accession #: np_033548) igdflkdkydsasemvvekhresrgwvetlrprytyfkvpterdlvyyea. The wnt-3a blocking peptide is derived from synthetic. The wnt-3a blocking peptide has been validated for the following applications: antibody competition.
Additional Information
| SKU | 10179466 |
|---|---|
| UOM | Each |
| UNSPSC | 41105906 |
| Manufacturer Part Number | NBP174183PEP |
