Web Analytics
518-831-8000 sales@utechproducts.com

Nsun2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nsun2, Each

1,757.70

Details

Maturation of cytoplasmic trnas includes splicing of introns, which are located 1 nucleotide 3-prime from the anticodon in all intron-containing trna genes. In trna-leu(caa), the first position of the anticodon, c34, is converted to 5-methylcytosine, a modification necessary to stabilize the anticodon-codon pairing and correctly translate the mrna. Nsun2 encodes a methyltransferase that catalyzes the intron-dependent formation of 5-methylcytosine at c34 of trna-leu(caa) (brzezicha et al., 2006 [Pubmed 17071714]).[Supplied by omimsequence: pfvfipeddplfppiekfyaldpsfprmnlltrttegkkrqlymvskelrnvllnnsekmkvintgikvwcrnnsgeefdcafrlaq

Additional Information

SKU 10289139
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23182