Web Analytics
518-831-8000 sales@utechproducts.com

Nsun5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nsun5, Each

$ 1,757.70

Details

This gene encodes a protein with similarity to p120 (nol1), a 120kda proliferation-associated nucleolar antigen that is a member of an evolutionarily conserved protein family. This gene is deleted in williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [Provided by refseqsequence: qlprfvrvntlktcsddvvdyfkrqgfsyqgrasslddlralkgkhflldplmpellvfpaqtdlhehplyraghlil

Additional Information

SKU 10287521
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21311