Nudt14, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Nudt14, Each
$ 2,214.00
|
|
Details:
Udp-glucose (udpg) acts as the sugar donor in numerous glycosylation reactions, including those involved in the production of glycogen. Nudt14 is a udpg pyrophosphatase (ec 3.6.1.45) That hydrolyzes udpg to produce glucose 1-phosphate and ump (yagi et al., 2003 [Pubmed 12429023]).[Supplied by omimsequence: eaweecgyhlapsdlrrvatywsgvgltgsrqtmfytevtdaqrsgpggglveegelievvhlplegaqafaddpdipktlgvifgvswflsq
Additional Information
| SKU | 10290178 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24514 |
