Web Analytics
518-831-8000 sales@utechproducts.com

NUP88, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant NUP88, Each

1,757.70

Details:

The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins, a family of 50 to 100 proteins, are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene belongs to the nucleoporin family and is associated with the oncogenic nucleoporin CAN/Nup214 in a dynamic subcomplex. This protein is also overexpressed in a large number of malignant neoplasms and precancerous dysplasias. [provided by RefSeqSequence: QLLTRNVVFGLGGELFLWDGEDSSFLVVRLRGPSGGGEEPALSQYQRLLCINPPLFEIYQVLLSPTQHHVALIGIKGLMVLELPKRWGKNSEFEGGKSTVNCSTTPVAERFFTSSTSLTLKHAAWYPSEILDPHVV

Additional Information

SKU 10287652
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21456