Web Analytics
518-831-8000 sales@utechproducts.com

ODZ1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ODZ1, Each

1,757.70

Details:

The protein encoded by this gene belongs to the tenascin family and teneurin subfamily. It is expressed in the neurons and may function as a cellular signal transducer. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: IRTISRNQAHLNDMNIYEIASPADQELYQFTVNGTHLHTLNLITRDYVYNFTYNSEGDLGAITSSNGNSVHIRRDAGGMPLWLVVPGGQVYWLTISSNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGH

Additional Information

SKU 10292443
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28599