Web Analytics
518-831-8000 sales@utechproducts.com

Ogdh Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ogdh, Each

1,757.70

Details

This gene encodes one subunit of the 2-oxoglutarate dehydrogenase complex. This complex catalyzes the overall conversion of 2-oxoglutarate (alpha-ketoglutarate) to succinyl-coa and co(2) during the krebs cycle. The protein is located in the mitochondrial matrix and uses thiamine pyrophosphate as a cofactor. A congenital deficiency in 2-oxoglutarate dehydrogenase activity is believed to lead to hypotonia, metabolic acidosis, and hyperlactatemia. Alternative splicing results in multiple transcript variants encoding distinct isoformssequence: lrtcaaklrpltasqtvktfsqnrpaaartfqqircysapvaaepflsgtssnyveemycawlenpksv

Additional Information

SKU 10287311
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21069