Web Analytics
518-831-8000 sales@utechproducts.com

OPHN1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant OPHN1, Each

1,757.70

Details:

This gene encodes a Rho-GTPase-activating protein that promotes GTP hydrolysis of Rho subfamily members. Rho proteins are important mediators of intracellular signal transduction, which affects cell migration and cell morphogenesis. Mutations in this gene are responsible for OPHN1-related X-linked mental retardation with cerebellar hypoplasia and distinctive facial dysmorhphism. [provided by RefSeqSequence: RVTARRHKPITISKRLLRERTVFYTSSLDESEDEIQHQTPNGTITSSIEPPKPPQHPKLPIQRSGETDPGRKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKITPK

Additional Information

SKU 10292453
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28610