Web Analytics
518-831-8000 sales@utechproducts.com

Or4k1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Or4k1, Each

1,757.70

Details

Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of g-protein-coupled receptors (gpcr) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and g protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [Provided by refseqsequence: tvdlpfcgpnevdsffcdlplvielacmdtyemeimtltn

Additional Information

SKU 10288319
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22222