Web Analytics
518-831-8000 sales@utechproducts.com

Osbp2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Osbp2, Each

1,757.70

Details:

Oxysterols are byproducts of cholesterol that can have cytotoxic effects on many cell types. The membrane-bound protein encoded by this gene contains a pleckstrin homology (ph) domain and an oxysterol-binding region. It binds oxysterols such as 7-ketocholesterol and may inhibit their cytotoxicity. Alternate transcriptional splice variants have been observed but have not been fully characterized. [Provided by refseqsequence: srkwqralqyeqeqrvhleetieqlakqhnslerafhsapgrpanpsksfiegslltpkgedseededteyfdamedstsfitv

Additional Information

SKU 10287619
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21420