Osbpl2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Osbpl2, Each

Details:

This gene encodes a member of the oxysterol-binding protein (osbp) family, a group of intracellular lipid receptors. Most members contain an n-terminal pleckstrin homology domain and a highly conserved c-terminal osbp-like sterol-binding domain, although some members contain only the sterol-binding domain. This encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the golgi apparatus. Transcript variants encoding different isoforms have been described. [Provided by refseqsequence: veghiqdknkkklfmiygkwteclwgidpvsyesfkkqerrgdhlrkakldedsgkadsdvaddvpvaqetvqvipgskl