Otof Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Otof, Each

Details:

Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, dfnb9. The short form of the encoded protein has 3 c2 domains, a single carboxy-terminal transmembrane domain found also in the c. Elegans spermatogenesis factor fer-1 and human dysferlin, while the long form has 6 c2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multiple isoforms have been found for this gene. [Provided by refseqsequence: piivieiydqdsmgkadfmgrtfakplvkmadeaycpprfppqleyyqiyrgnatagdllaafellqigpagkadlppingpvdvdrgpimpvpmgirpvlskyrvevlfwglrdlkrvnl