Web Analytics
518-831-8000 sales@utechproducts.com

OTUD6B Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant OTUD6B, Each

1,757.70

Details:

Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.[supplied by OMIMSequence: IQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLKLTTKENKIDSVAVNISNLV

Additional Information

SKU 10288088
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21947