Web Analytics
518-831-8000 sales@utechproducts.com

OTX2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant OTX2, Each

1,750.95

Details:

This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined. [provided by RefSeqSequence: SSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYK

Additional Information

SKU 10286361
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB19983