Web Analytics
518-831-8000 sales@utechproducts.com

PANX2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PANX2, Each

1,757.70

Details:

The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nervous system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 1 may form cell type-specific gap junctions with distinct properties. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: SNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPS

Additional Information

SKU 10289424
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23512