Pawr Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pawr, Each

Details:

The tumor suppressor wt1 represses and activates transcription. The protein encoded by this gene is a wt1-interacting protein that itself functions as a transcriptional repressor. It contains a putative leucine zipper domain which interacts with the zinc finger dna binding domain of wt1. This protein is specifically upregulated during apoptosis of prostate cells. [Provided by refseqsequence: lqepprtvsgryksttsvseedvssrysrtdrsgfprynrdanvsgtlvssstlekkiedlekevvrerqenlrlvrlmqdkeemigklkeeidllnrdlddiedeneqlkqenkt