Web Analytics
518-831-8000 sales@utechproducts.com

PDE4D Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PDE4D, Each

1,757.70

Details:

This gene encodes one of four mammalian counterparts to the fruit fly 'dunce' gene. The encoded protein has 3',5'-cyclic-AMP phosphodiesterase activity and degrades cAMP, which acts as a signal transduction molecule in multiple cell types. This gene uses different promoters to generate multiple alternatively spliced transcript variants that encode functional proteinsSequence: FELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPLDEQVEEEAVG

Additional Information

SKU 10292217
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28329