Web Analytics
518-831-8000 sales@utechproducts.com

Pear1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pear1, Each

1,757.70

Details

Pear1 is a platelet receptor that signals upon the formation of platelet-platelet contacts independent of platelet activation and secondary to platelet aggregation (nanda et al., 2005 [Pubmed 15851471]).[Supplied by omimsequence: psdpntcsfwesfttttkeshsrpfsllpsepcerpwegphtcpqptvvyrtvyrqvvktdhrqrlqcchgfyes

Additional Information

SKU 10288868
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22861