Pear1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pear1, Each
$ 1,757.70
|
|
Details:
Pear1 is a platelet receptor that signals upon the formation of platelet-platelet contacts independent of platelet activation and secondary to platelet aggregation (nanda et al., 2005 [Pubmed 15851471]).[Supplied by omimsequence: psdpntcsfwesfttttkeshsrpfsllpsepcerpwegphtcpqptvvyrtvyrqvvktdhrqrlqcchgfyes
Additional Information
| SKU | 10288868 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22861 |
Loading Cart Data 