Web Analytics
518-831-8000 sales@utechproducts.com

PEBP4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant PEBP4, Each

1,757.70

Details:

The phosphatidylethanolamine (PE)-binding proteins, including PEBP4, are an evolutionarily conserved family of proteins with pivotal biologic functions, such as lipid binding and inhibition of serine proteases (Wang et al., 2004 [PubMed 15302887]).[supplied by OMIMSequence: EGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHK

Additional Information

SKU 10287927
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21759