Web Analytics
518-831-8000 sales@utechproducts.com

Pebp4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Pebp4, Each

1,757.70

Details

The phosphatidylethanolamine (pe)-binding proteins, including pebp4, are an evolutionarily conserved family of proteins with pivotal biologic functions, such as lipid binding and inhibition of serine proteases (wang et al., 2004 [Pubmed 15302887]).[Supplied by omimsequence: egkvisllpkenktrgswkmdrflnrfhlgepeastqfmtqnyqdsptlqaprerasepkhk

Additional Information

SKU 10287927
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21759